PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_020223-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 201aa    MW: 21936.1 Da    PI: 9.0623
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_020223-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding383.9e-12245346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE++ ++ + + lG+g+W+ I+r + + Rt+ q+ s+ qk
    NNU_020223-RA  2 PWTKEEHKTFLAGLESLGKGDWRGISRNFVLSRTPTQVASHGQK 45
                     7****************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.481151IPR017930Myb domain
PfamPF002497.7E-9245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-10242IPR009057Homeodomain-like
CDDcd001674.45E-8242No hitNo description
SuperFamilySSF466891.12E-12250IPR009057Homeodomain-like
SMARTSM007171.3E-4249IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.8E-13250IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
IPWTKEEHKT FLAGLESLGK GDWRGISRNF VLSRTPTQVA SHGQKNFLRQ FTSNRKKRRS  60
NLFDDPSHTA PGLPLKPIIQ FHEQAGTSAQ IAKQVAVRGL EGPTVVPMSA TWITPDFVGM  120
PHMGGISSGK LTNPATTTDL PTASFIPAMN HPILDYGYLP KACTTLASTA ISLESTFNLC  180
PQPIMQCESQ AASSRNFCCE H
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258762.11e-123PREDICTED: transcription factor MYB1R1-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-28MYB_related family protein